HSPB2 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04785
Article Name: HSPB2 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04785
Supplier Catalog Number: OPCA04785
Alternative Catalog Number: ASB-OPCA04785-100UG, ASB-OPCA04785-1MG, ASB-OPCA04785-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: DMPK-binding protein,heat shock 27kDa protein 2,heat shock protein beta-2,heat-shock protein beta-2,Hs.78846,HSP27,LOH11CR1K,MKBP.
May regulate the kinase DMPK.
Molecular Weight: 47.2 kDa
Tag: N-terminal GST-tagged
NCBI: 3316
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP