POLR1D Recombinant Protein (Human)

Catalog Number: ASB-OPCA04789
Article Name: POLR1D Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04789
Supplier Catalog Number: OPCA04789
Alternative Catalog Number: ASB-OPCA04789-100UG, ASB-OPCA04789-1MG, ASB-OPCA04789-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: AC19,DNA-directed RNA polymerase I subunit D,DNA-directed RNA polymerases I and III subunit RPAC2,hRPA19,POLR1C,polymerase (RNA) I polypeptide D, 16kDa,polymerase (RNA) I subunit D,Protein POLR1D,RNA polymerase I 16 kDa subunit,RNA polymerase I subunit D,RNA polymerases I and III subunit AC2,RPA16,RPA9,RPAC2,RPC16,RPO1-3,TCS2.
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.
Molecular Weight: 42.2 kDa
Tag: N-terminal GST-tagged
NCBI: 51082
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF