SUMO4 Recombinant Protein (Human)

Catalog Number: ASB-OPCA04802
Article Name: SUMO4 Recombinant Protein (Human)
Biozol Catalog Number: ASB-OPCA04802
Supplier Catalog Number: OPCA04802
Alternative Catalog Number: ASB-OPCA04802-100UG, ASB-OPCA04802-1MG, ASB-OPCA04802-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: dJ281H8.4,IDDM5,insulin-dependent diabetes mellitus 5,small ubiquitin-like modifier 4 protein,Small ubiquitin-like protein 4,small ubiquitin-related modifier 4,SMT3 suppressor of mif two 3 homolog 2,SMT3 suppressor of mif two 3 homolog 4,SMT3H4,SUMO-4.
Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
Molecular Weight: 37.7 kDa
Tag: N-terminal GST-tagged
NCBI: 387082
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY