Recombinant SARS-CoV-2 Spike Glycoprotein

Catalog Number: ASB-OPCA335982
Article Name: Recombinant SARS-CoV-2 Spike Glycoprotein
Biozol Catalog Number: ASB-OPCA335982
Supplier Catalog Number: OPCA335982
Alternative Catalog Number: ASB-OPCA335982-100UG,ASB-OPCA335982-1MG,ASB-OPCA335982-20UG
Manufacturer: Aviva
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Virus
Alternative Names: E2,GU280_gp02,Peplomer protein,spike glycoprotein,surface glycoprotein., sars-cov-2
Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein (PubMed:32142651, PubMed:32221306, PubMed:32075877, PubMed:32155444). Binding to host NRP1 and NRP2 via C-terminal polybasic sequence enhances virion entry into host cell (PubMed:33082294, PubMed:33082293). This interaction may explain virus tropism of human olfactory epithelium cells, which express high level of NRP1 and NRP2 but low level of ACE2 (PubMed:33082293). The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed:32817270). Uses human TMPRSS2 for priming in human lung cells which is an essential step for viral entry (PubMed:32142651). Can be alternatively processed by host furin (PubMed:32362314). Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membrane fusion within endosomes.
Molecular Weight: 79.6 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged
NCBI: 43740568
UniProt: P0DTC2
Source: Mammalian Cells
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized
Sequence: Partial Protein: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGD