Anti-IDH1 Antibody , IgG2a, Clone: [CL0219], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90578
Article Name: Anti-IDH1 Antibody , IgG2a, Clone: [CL0219], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90578
Supplier Catalog Number: AMAb90578
Alternative Catalog Number: ATA-AMAB90578-100,ATA-AMAB90578-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
isocitrate dehydrogenase 1 (NADP+), soluble
Anti-IDH1
Clonality: Monoclonal
Concentration: 0.1
Clone Designation: [CL0219]
Isotype: IgG2a
NCBI: 3417
UniProt: O75874
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IDH1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunofluorescence staining of A-431 cells using the anti-IDH1 monoclonal antibody, showing specific staining in the cytosol and nuclear bodies in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemical staining of human kidney shows strong positivity in a subset of renal tubules.
Immunohistochemical staining of human testis shows strong immunoreactivity in seminiferous tubules.
Immunohistochemical staining of human prostate shows strong positivity in glandular epithelium.
Western blot analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90578
AMAb90578
AMAb90578