Anti-STX7 Antibody , IgG1, Clone: [CL0257], Unconjugated, Mouse, Monoclonal
Catalog Number:
ATA-AMAB90616
- Images (9)
| Article Name: | Anti-STX7 Antibody , IgG1, Clone: [CL0257], Unconjugated, Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90616 |
| Supplier Catalog Number: | AMAb90616 |
| Alternative Catalog Number: | ATA-AMAB90616-100,ATA-AMAB90616-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | STX7 |
| syntaxin 7 |
| Anti-STX7 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0257] |
| Isotype: | IgG1 |
| NCBI: | 8417 |
| UniProt: | O15400 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | STX7 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human melanoma shows strong cytoplasmic and membrane positivity in tumour cells. |
|
|
Immunohistochemical staining of human melanoma shows strong cytoplasmic positivity in tumour cells. |
|
|
Immunohistochemical staining of human lymph node shows strong membrane positivity in non-germinal center cells. |
|
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
|
AMAb90616 |
|
|
|
|
|
|
|
|
AMAb90616 |
|
|
AMAb90616 |
Product Guarantee and Expert Support
