Anti-STX7 Antibody , IgG1, Clone: [CL0257], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90616
Article Name: Anti-STX7 Antibody , IgG1, Clone: [CL0257], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90616
Supplier Catalog Number: AMAb90616
Alternative Catalog Number: ATA-AMAB90616-100,ATA-AMAB90616-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: STX7
syntaxin 7
Anti-STX7
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL0257]
Isotype: IgG1
NCBI: 8417
UniProt: O15400
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STX7
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml
Immunohistochemical staining of human melanoma shows strong cytoplasmic and membrane positivity in tumour cells.
Immunohistochemical staining of human melanoma shows strong cytoplasmic positivity in tumour cells.
Immunohistochemical staining of human lymph node shows strong membrane positivity in non-germinal center cells.
Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate
AMAb90616
AMAb90616
AMAb90616