Anti-CTCF
Catalog Number:
ATA-AMAB90664
- Images (10)
| Article Name: | Anti-CTCF |
| Biozol Catalog Number: | ATA-AMAB90664 |
| Supplier Catalog Number: | AMAb90664 |
| Alternative Catalog Number: | ATA-AMAB90664-100,ATA-AMAB90664-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CTCF |
| CCCTC-binding factor (zinc finger protein) |
| Anti-CTCF |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0305] |
| Isotype: | IgG1 |
| NCBI: | 10664 |
| UniProt: | P49711 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CTCF |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:500 - 1:1000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong nuclear positivity in cells in tubuli and glomeruli. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG |
|
|
AMAb90664-100ul |
|
|
|
|
|
|
|
|
AMAb90664-100ul |
|
|
AMAb90664-100ul |
Product Guarantee and Expert Support
