Anti-SDHB, IgG2a, Clone: [CL0346], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90705
- Images (9)
| Article Name: | Anti-SDHB, IgG2a, Clone: [CL0346], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90705 |
| Supplier Catalog Number: | AMAb90705 |
| Alternative Catalog Number: | ATA-AMAB90705-100,ATA-AMAB90705-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SDH, SDH1 |
| succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Anti-SDHB |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0346] |
| Isotype: | IgG2a |
| NCBI: | 6390 |
| UniProt: | P21912 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SDHB |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in the hepatocytes. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in renal tubuli. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in the glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic immunoreactivity in the seminiferous tubules. |
|
|
Lane 1: Marker [kDa] Lane 2: Human cell line RT-4 |
|
|
AMAb90705 |
|
|
|
|
|
AMAb90705 |
|
|
AMAb90705 |
Product Guarantee and Expert Support
