Anti-SDHB Antibody , IgG2a, Clone: [CL0346], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-SDHB Antibody , IgG2a, Clone: [CL0346], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90705
• Supplier Catalog Number: AMAb90705
• Alternative Catalog Number: ATA-AMAB90705-100,ATA-AMAB90705-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: SDH, SDH1

Product Description

succinate dehydrogenase complex, subunit B, iron sulfur (Ip)

Additional Information

Anti-SDHB

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL0346]
• Isotype: IgG2a
• NCBI: 6390
• UniProt: P21912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SDHB
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml

Images

Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in the hepatocytes.

Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in renal tubuli.

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in the glandular cells.

Immunohistochemical staining of human testis shows moderate cytoplasmic immunoreactivity in the seminiferous tubules.

Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4

AMAb90705

AMAb90705

AMAb90705