Anti-SDHB Antibody , IgG2a, Clone: [CL0346], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90705
Article Name: Anti-SDHB Antibody , IgG2a, Clone: [CL0346], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90705
Supplier Catalog Number: AMAb90705
Alternative Catalog Number: ATA-AMAB90705-100,ATA-AMAB90705-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SDH, SDH1
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Anti-SDHB
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL0346]
Isotype: IgG2a
NCBI: 6390
UniProt: P21912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SDHB
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 1 µg/ml
Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in the hepatocytes.
Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity in renal tubuli.
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in the glandular cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic immunoreactivity in the seminiferous tubules.
Lane 1: Marker [kDa]
Lane 2: Human cell line RT-4
AMAb90705
AMAb90705
AMAb90705