Anti-MRC1, IgG2b, Clone: [CL0387], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90746
- Images (9)
| Article Name: | Anti-MRC1, IgG2b, Clone: [CL0387], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90746 |
| Supplier Catalog Number: | AMAb90746 |
| Alternative Catalog Number: | ATA-AMAB90746-100,ATA-AMAB90746-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1 |
| mannose receptor, C type 1 |
| Anti-MRC1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL0387] |
| Isotype: | IgG2b |
| NCBI: | None |
| UniProt: | P22897 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MRC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human lung shows strong immunoreactivity in macrophages. |
|
|
Immunohistochemical staining of human liver shows strong positivity in Kupffer cells. |
|
|
Immunohistochemical staining of human rectum shows moderate positivity in a subset of lymphoid cells. |
|
|
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human liver tissue lysate |
|
|
AMAb90746 |
|
|
|
|
|
AMAb90746 |
|
|
AMAb90746 |
Product Guarantee and Expert Support
