Anti-MRC1 Antibody , IgG2b, Clone: [CL0387], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-MRC1 Antibody , IgG2b, Clone: [CL0387], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB90746
• Supplier Catalog Number: AMAb90746
• Alternative Catalog Number: ATA-AMAB90746-100,ATA-AMAB90746-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1

Product Description

mannose receptor, C type 1

Additional Information

Anti-MRC1

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL0387]
• Isotype: IgG2b
• NCBI: None
• UniProt: P22897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MRC1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml

Images

Immunohistochemical staining of human lung shows strong immunoreactivity in macrophages.

Immunohistochemical staining of human liver shows strong positivity in Kupffer cells.

Immunohistochemical staining of human rectum shows moderate positivity in a subset of lymphoid cells.

Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).

Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate

AMAb90746

AMAb90746

AMAb90746