Anti-MRC1 Antibody , IgG2b, Clone: [CL0387], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90746
Article Name: Anti-MRC1 Antibody , IgG2b, Clone: [CL0387], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90746
Supplier Catalog Number: AMAb90746
Alternative Catalog Number: ATA-AMAB90746-100,ATA-AMAB90746-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA541I19.1, CD206, CLEC13D, CLEC13DL, MRC1L1
mannose receptor, C type 1
Anti-MRC1
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL0387]
Isotype: IgG2b
NCBI: None
UniProt: P22897
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MRC1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 1 µg/ml
Immunohistochemical staining of human lung shows strong immunoreactivity in macrophages.
Immunohistochemical staining of human liver shows strong positivity in Kupffer cells.
Immunohistochemical staining of human rectum shows moderate positivity in a subset of lymphoid cells.
Immunohistochemical staining of human cerebellum shows absence of immunoreactivity (negative control).
Lane 1: Marker [kDa]
Lane 2: Human liver tissue lysate
AMAb90746
AMAb90746
AMAb90746