Anti-SLC22A2
Catalog Number:
ATA-AMAB90792
- Images (7)
| Article Name: | Anti-SLC22A2 |
| Biozol Catalog Number: | ATA-AMAB90792 |
| Supplier Catalog Number: | AMAb90792 |
| Alternative Catalog Number: | ATA-AMAB90792-100,ATA-AMAB90792-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | OCT2 |
| solute carrier family 22 (organic cation transporter), member 2 |
| Anti-SLC22A2 |
| Clonality: | Monoclonal |
| Concentration: | 0.5 |
| Clone Designation: | [CL0631] |
| Isotype: | IgG2b |
| NCBI: | 6582 |
| UniProt: | O15244 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SLC22A2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human kidney and pancreas tissues using AMAb90792 antibody. Corresponding SLC22A2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows strong positivity in apical membrane in cells in tubules. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong membranous positivity in astrocytes. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in either exocrine or endocrine glandular cells as expected. |
|
|
AMAb90792-100ul |
|
|
AMAb90792-100ul |
|
|
AMAb90792-100ul |
Product Guarantee and Expert Support
