Anti-CD3E
Catalog Number:
ATA-AMAB90876
- Images (10)
| Article Name: | Anti-CD3E |
| Biozol Catalog Number: | ATA-AMAB90876 |
| Supplier Catalog Number: | AMAb90876 |
| Alternative Catalog Number: | ATA-AMAB90876-100,ATA-AMAB90876-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Pan-Cancer |
| CD3e molecule, epsilon (CD3-TCR complex) |
| Anti-CD3E |
| Clonality: | Monoclonal |
| Concentration: | 0.1 |
| Clone Designation: | [CL1466] |
| Isotype: | IgG1 |
| NCBI: | 916 |
| UniProt: | P07766 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD3E |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using AMAb90876 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity, mainly in in non - germinal center cells. |
|
|
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
Lane 1: Marker [kDa] Lane 2: Human tonsil tissue lysate |
|
|
AMAb90876-100ul |
|
|
|
|
|
AMAb90876-100ul |
|
|
AMAb90876-100ul |
Product Guarantee and Expert Support
