Anti-CD3E Antibody , IgG1, Clone: [CL1466], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90876
Article Name: Anti-CD3E Antibody , IgG1, Clone: [CL1466], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90876
Supplier Catalog Number: AMAb90876
Alternative Catalog Number: ATA-AMAB90876-100,ATA-AMAB90876-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Pan-Cancer
CD3e molecule, epsilon (CD3-TCR complex)
Anti-CD3E
Clonality: Monoclonal
Concentration: 0.1
Clone Designation: [CL1466]
Isotype: IgG1
NCBI: 916
UniProt: P07766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: NEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CD3E
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemistry analysis in human tonsil and skeletal muscle tissues using AMAb90876 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong membranous positivity, mainly in in non - germinal center cells.
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphoid cells.
Immunohistochemical staining of human fallopian tube shows moderate membranous positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Lane 1: Marker [kDa]
Lane 2: Human tonsil tissue lysate
AMAb90876
AMAb90876
AMAb90876