Anti-CD40, IgG1, Clone: [CL1673], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90905
- Images (9)
| Article Name: | Anti-CD40, IgG1, Clone: [CL1673], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90905 |
| Supplier Catalog Number: | AMAb90905 |
| Alternative Catalog Number: | ATA-AMAB90905-100,ATA-AMAB90905-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | Bp50, p50, TNFRSF5 |
| CD40 molecule, TNF receptor superfamily member 5 |
| Anti-CD40 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL1673] |
| Isotype: | IgG1 |
| NCBI: | 958 |
| UniProt: | P25942 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD40 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using AMAb90905 antibody. Corresponding CD40 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity in germinal center cells. |
|
|
Immunohistochemical staining of human colon shows moderate membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neuronal cells as expected. |
|
|
Lane 1: Marker [kDa] Lane 2: Human spleen |
|
|
AMAb90905 |
|
|
|
|
|
AMAb90905 |
|
|
AMAb90905 |
Product Guarantee and Expert Support
