Anti-MYH6 Antibody , IgG2b, Clone: [CL2162], Unconjugated, Mouse, Monoclonal

Catalog Number: ATA-AMAB90950
Article Name: Anti-MYH6 Antibody , IgG2b, Clone: [CL2162], Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: ATA-AMAB90950
Supplier Catalog Number: AMAb90950
Alternative Catalog Number: ATA-AMAB90950-100,ATA-AMAB90950-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MYH6
myosin, heavy chain 6, cardiac muscle, alpha
Anti-MYH6
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL2162]
Isotype: IgG2b
NCBI: 4624
UniProt: P13533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MYH6
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:5000 - 1:10000, WB: 1 µg/ml
Immunohistochemistry analysis in human heart muscle and liver tissues using AMAb90950 antibody. Corresponding MYH6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows very strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Lane 1: Marker [kDa]
Lane 2: Human skeletal muscle tissue lysate
AMAb90950
AMAb90950
AMAb90950