Anti-MYH6, IgG2b, Clone: [CL2162], Mouse, Monoclonal
Catalog Number:
ATA-AMAB90950
- Images (9)
| Article Name: | Anti-MYH6, IgG2b, Clone: [CL2162], Mouse, Monoclonal |
| Biozol Catalog Number: | ATA-AMAB90950 |
| Supplier Catalog Number: | AMAb90950 |
| Alternative Catalog Number: | ATA-AMAB90950-100,ATA-AMAB90950-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MYH6 |
| myosin, heavy chain 6, cardiac muscle, alpha |
| Anti-MYH6 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2162] |
| Isotype: | IgG2b |
| NCBI: | 4624 |
| UniProt: | P13533 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MYH6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:5000 - 1:10000, WB: 1 µg/ml |
|
|
Immunohistochemistry analysis in human heart muscle and liver tissues using AMAb90950 antibody. Corresponding MYH6 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human heart muscle shows very strong cytoplasmic positivity in cardiomyocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Lane 1: Marker [kDa] Lane 2: Human skeletal muscle tissue lysate |
|
|
AMAb90950 |
|
|
|
|
|
AMAb90950 |
|
|
AMAb90950 |
Product Guarantee and Expert Support
