Anti-LY6K
Catalog Number:
ATA-AMAB90986
- Images (6)
| Article Name: | Anti-LY6K |
| Biozol Catalog Number: | ATA-AMAB90986 |
| Supplier Catalog Number: | AMAb90986 |
| Alternative Catalog Number: | ATA-AMAB90986-100,ATA-AMAB90986-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CT97, FLJ35226, HSJ001348 |
| lymphocyte antigen 6 complex, locus K |
| Anti-LY6K |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL2433] |
| Isotype: | IgG1 |
| NCBI: | 54742 |
| UniProt: | Q17RY6 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | LY6K |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic immunoreactivity in a subset of cells in seminiferous tubules. |
|
|
Immunohistochemical staining of human liver shows absence of immunoreactivity (negative control). |
|
|
Lane 1: Marker [kDa] Lane 2: Human testis tissue lysate |
|
|
AMAb90986-100ul |
|
|
AMAb90986-100ul |
|
|
AMAb90986-100ul |
Product Guarantee and Expert Support
