Anti-TYRP1

Catalog Number: ATA-AMAB91326
Article Name: Anti-TYRP1
Biozol Catalog Number: ATA-AMAB91326
Supplier Catalog Number: AMAb91326
Alternative Catalog Number: ATA-AMAB91326-100,ATA-AMAB91326-25
Manufacturer: Atlas Antibodies
Host: Mouse
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAS2, TYRP, TYRRP, TRP
tyrosinase-related protein 1
Anti-TYRP1
Clonality: Monoclonal
Concentration: 1
Clone Designation: [CL4906]
Isotype: IgG2a
NCBI: 7306
UniProt: P17643
Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Protein A purified
Sequence: VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TYRP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml
Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected (negative control).
Western blot analysis in human cell line SK-MEL-30.
AMAb91326-100ul
AMAb91326-100ul
AMAb91326-100ul