Anti-TYRP1
Catalog Number:
ATA-AMAB91328
- Images (7)
| Article Name: | Anti-TYRP1 |
| Biozol Catalog Number: | ATA-AMAB91328 |
| Supplier Catalog Number: | AMAb91328 |
| Alternative Catalog Number: | ATA-AMAB91328-100,ATA-AMAB91328-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Mouse |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAS2, TYRP, TYRRP, TRP |
| tyrosinase-related protein 1 |
| Anti-TYRP1 |
| Clonality: | Monoclonal |
| Concentration: | 1 |
| Clone Designation: | [CL4923] |
| Isotype: | IgG1 |
| NCBI: | 7306 |
| UniProt: | P17643 |
| Buffer: | The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Protein A purified |
| Sequence: | VCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TYRP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 2-10 µg/ml, IHC: 1:1000 - 1:2500, WB: 1 µg/ml |
|
|
Immunohistochemical staining of human skin shows strong cytoplasmic immunoreactivity in melanocytes. |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected (negative control). |
|
|
Western blot analysis in human cell line SK-MEL-30. |
|
|
AMAb91328-100ul |
|
|
AMAb91328-100ul |
|
|
|
|
|
AMAb91328-100ul |
Product Guarantee and Expert Support
