Anti-GRN Antibody , IgG1, Clone: [CL5695], Unconjugated, Mouse, Monoclonal

Product Overview

• Article Name: Anti-GRN Antibody , IgG1, Clone: [CL5695], Unconjugated, Mouse, Monoclonal
• Biozol Catalog Number: ATA-AMAB91385
• Supplier Catalog Number: AMAb91385
• Alternative Catalog Number: ATA-AMAB91385-100,ATA-AMAB91385-25
• Manufacturer: Atlas Antibodies
• Host: Mouse
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CLN11, PCDGF, PGRN

Product Description

granulin

Additional Information

Anti-GRN

Product Properties

• Clonality: Monoclonal
• Concentration: 1
• Clone Designation: [CL5695]
• Isotype: IgG1
• NCBI: 2896
• UniProt: P28799
• Buffer: The antibodies are delivered in 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Protein A purified
• Sequence: SCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: GRN
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:1000 - 1:2500, WB: 1 µg/ml

Images

Immunohistochemical staining of human endometrium shows moderate granular cytoplasmic immunoreactivity in glandular cells.

Immunohistochemical staining of human liver shows cytoplasmic immunoreactivity in Kupffer cells.

Immunohistochemical staining of human prostate shows moderate granular cytoplasmic immunoreactivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows absence of positivity in striated muscle fibers as expected (negative control).

Western blot analysis in human cell line PC-3.

AMAb91385

AMAb91385

AMAb91385