Anti-DKC1
Catalog Number:
ATA-HPA000166
- Images (6)
| Article Name: | Anti-DKC1 |
| Biozol Catalog Number: | ATA-HPA000166 |
| Supplier Catalog Number: | HPA000166 |
| Alternative Catalog Number: | ATA-HPA000166-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKC, dyskerin, NAP57, NOLA4, XAP101 |
| dyskeratosis congenita 1, dyskerin |
| Anti-DKC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 1736 |
| UniProt: | O60832 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DKC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells. |
|
|
Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA000166-100ul |
|
|
|
|
|
HPA000166-100ul |
|
|
HPA000166-100ul |
Product Guarantee and Expert Support
