Anti-RDX

Catalog Number: ATA-HPA000263
Article Name: Anti-RDX
Biozol Catalog Number: ATA-HPA000263
Supplier Catalog Number: HPA000263
Alternative Catalog Number: ATA-HPA000263-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DFNB24
radixin
Anti-RDX
Clonality: Polyclonal
Isotype: IgG
NCBI: 5962
UniProt: P35241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RDX
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA000263-100ul
HPA000263-100ul
HPA000263-100ul