Anti-GAB2

Catalog Number: ATA-HPA000271
Article Name: Anti-GAB2
Biozol Catalog Number: ATA-HPA000271
Supplier Catalog Number: HPA000271
Alternative Catalog Number: ATA-HPA000271-100,ATA-HPA000271-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0571
GRB2-associated binding protein 2
Anti-GAB2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 9846
UniProt: Q9UQC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GAB2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human bone marrow and skeletal muscle tissues using HPA000271 antibody. Corresponding GAB2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
HPA000271-100ul
HPA000271-100ul
HPA000271-100ul