Anti-ACE2

Catalog Number: ATA-HPA000288
Article Name: Anti-ACE2
Biozol Catalog Number: ATA-HPA000288
Supplier Catalog Number: HPA000288
Alternative Catalog Number: ATA-HPA000288-100,ATA-HPA000288-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ACE2
angiotensin I converting enzyme 2

Anti-ACE2

The ACE2 receptor / a SAS Cov-2 cofactor

It is established that the ACE2 receptor is the main entry point for the SARS-CoV-2 virus in the lung (a host cell receptor for SARS-CoV-2; Hoffmann et al. 2020, Yan et al. 2020). ACE2 is mainly expressed on the surface of the cells within the lung, i.e. AECII-cells (Yan et al. 2020) and a transient bronchial secretory cell type transitioning from secretory to ciliated identity. These cells appear particularly vulnerable to SARS-CoV-2 infection (Lucassen et al. 2020 in press).

References:

Hoffmann M et al. (2020), SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell 181, Issue 2, 1271-280.e8

Lukassen S. et al. (2020), SARS‐CoV‐2 receptor ACE2 and TMPRSS2 are primarily expressed in bronchial transient secretory cells. EMBO J (2020)e105114https://doi.org/10.15252/embj.20105114

Yan R et al. (2020) Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science, 6485,1444-1448

Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 59272
UniProt: Q9BYF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ACE2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human small intestine and tonsil tissues using HPA000288 antibody. Corresponding ACE2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human small intestine shows strong positivity in apical membranes in glandular cells.
Immunohistochemical staining of human duodenum shows strong positivity in apical membranes in glandular cells.
Immunohistochemical staining of human kidney shows strong positivity in apical membrane in cells in tubules.
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Western blot analysis in human kidney tissue.
HPA000288-100ul
HPA000288-100ul
HPA000288-100ul