Anti-TRIM13
Catalog Number:
ATA-HPA000367
- Images (8)
| Article Name: | Anti-TRIM13 |
| Biozol Catalog Number: | ATA-HPA000367 |
| Supplier Catalog Number: | HPA000367 |
| Alternative Catalog Number: | ATA-HPA000367-100,ATA-HPA000367-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DLEU5, Leu5, RFP2, RNF77 |
| tripartite motif containing 13 |
| Anti-TRIM13 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10206 |
| UniProt: | O60858 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TRIM13 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and duodenum tissues using Anti-TRIM13 antibody. Corresponding TRIM13 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TRIM13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403907). |
|
|
HPA000367-100ul |
|
|
|
|
|
HPA000367-100ul |
|
|
HPA000367-100ul |
Product Guarantee and Expert Support
