Anti-FOXP2
Catalog Number:
ATA-HPA000382
- Images (8)
| Article Name: | Anti-FOXP2 |
| Biozol Catalog Number: | ATA-HPA000382 |
| Supplier Catalog Number: | HPA000382 |
| Alternative Catalog Number: | ATA-HPA000382-100,ATA-HPA000382-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAGH44, SPCH1, TNRC10 |
| forkhead box P2 |
| Anti-FOXP2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 93986 |
| UniProt: | O15409 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AQQLVFQQQLLQMQQLQQQQHLLSLQRQGLISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTSSNTSKASPPITHHS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FOXP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons. |
|
|
Immunohistochemical staining of human rectum shows moderate nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows moderate nuclear positivity in deep epidermal cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA000382-100ul |
|
|
|
|
|
HPA000382-100ul |
|
|
HPA000382-100ul |
Product Guarantee and Expert Support
