Anti-TMX4
Catalog Number:
ATA-HPA000399
- Images (8)
| Article Name: | Anti-TMX4 |
| Biozol Catalog Number: | ATA-HPA000399 |
| Supplier Catalog Number: | HPA000399 |
| Alternative Catalog Number: | ATA-HPA000399-100,ATA-HPA000399-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DJ971N18.2, KIAA1162, PDIA14, TXNDC13 |
| thioredoxin-related transmembrane protein 4 |
| Anti-TMX4 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 56255 |
| UniProt: | Q9H1E5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TMX4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-TMX4 antibody. Corresponding TMX4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA000399-100ul |
|
|
|
|
|
HPA000399-100ul |
|
|
HPA000399-100ul |
Product Guarantee and Expert Support
