Anti-CD45

Catalog Number: ATA-HPA000440
Article Name: Anti-CD45
Biozol Catalog Number: ATA-HPA000440
Supplier Catalog Number: HPA000440
Alternative Catalog Number: ATA-HPA000440-100,ATA-HPA000440-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PTPRC, GP180, LCA, T200
protein tyrosine phosphatase, receptor type C
Anti-CD45
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 5788
UniProt: None
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTPRC
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-CD45 antibody. Corresponding CD45 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA000440-100ul
HPA000440-100ul
HPA000440-100ul