Anti-MKI67
Catalog Number:
ATA-HPA000451
- Images (8)
| Article Name: | Anti-MKI67 |
| Biozol Catalog Number: | ATA-HPA000451 |
| Supplier Catalog Number: | HPA000451 |
| Alternative Catalog Number: | ATA-HPA000451-100,ATA-HPA000451-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | MIB-, PPP1R105 |
| marker of proliferation Ki-67 |
| Anti-MKI67 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 4288 |
| UniProt: | P46013 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PAKVEDAADSATKPENLSSKTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFGDSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MKI67 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-MKI67 antibody. Corresponding MKI67 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
|
|
|
HPA000451-100ul |
|
|
HPA000451-100ul |
|
|
HPA000451-100ul |
Product Guarantee and Expert Support
