Anti-CCNB3

Catalog Number: ATA-HPA000496
Article Name: Anti-CCNB3
Biozol Catalog Number: ATA-HPA000496
Supplier Catalog Number: HPA000496
Alternative Catalog Number: ATA-HPA000496-100,ATA-HPA000496-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CCNB3
cyclin B3
Anti-CCNB3
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 85417
UniProt: Q8WWL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CCNB3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry analysis in human testis and liver tissues using HPA000496 antibody. Corresponding CCNB3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows strong nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
HPA000496-100ul
HPA000496-100ul
HPA000496-100ul