Anti-PITPNB

Catalog Number: ATA-HPA000528
Article Name: Anti-PITPNB
Biozol Catalog Number: ATA-HPA000528
Supplier Catalog Number: HPA000528
Alternative Catalog Number: ATA-HPA000528-100,ATA-HPA000528-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: VIB1B
phosphatidylinositol transfer protein, beta
Anti-PITPNB
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23760
UniProt: P48739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PITPNB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and membranous positivity in urothelial cells.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA000528-100ul
HPA000528-100ul
HPA000528-100ul