Anti-SOX11
Catalog Number:
ATA-HPA000536
- Images (6)
| Article Name: | Anti-SOX11 |
| Biozol Catalog Number: | ATA-HPA000536 |
| Supplier Catalog Number: | HPA000536 |
| Alternative Catalog Number: | ATA-HPA000536-100,ATA-HPA000536-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SOX11 |
| SRY (sex determining region Y)-box 11 |
| Anti-SOX11 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 6664 |
| UniProt: | P35716 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SOX11 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells. |
|
|
Immunohistochemical staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected. |
|
|
Western blot analysis in human cell line SH-SY5Y. |
|
|
HPA000536-100ul |
|
|
HPA000536-100ul |
|
|
HPA000536-100ul |
Product Guarantee and Expert Support
