Anti-MLLT11
Catalog Number:
ATA-HPA000540
- Images (6)
| Article Name: | Anti-MLLT11 |
| Biozol Catalog Number: | ATA-HPA000540 |
| Supplier Catalog Number: | HPA000540 |
| Alternative Catalog Number: | ATA-HPA000540-100,ATA-HPA000540-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AF1Q |
| myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), translocated to, 11 |
| Anti-MLLT11 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 10962 |
| UniProt: | Q13015 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | FWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFEL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MLLT11 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells. |
|
|
HPA000540-100ul |
|
|
|
|
|
HPA000540-100ul |
|
|
HPA000540-100ul |
Product Guarantee and Expert Support
