Anti-DHRS1

Catalog Number: ATA-HPA000599
Article Name: Anti-DHRS1
Biozol Catalog Number: ATA-HPA000599
Supplier Catalog Number: HPA000599
Alternative Catalog Number: ATA-HPA000599-100,ATA-HPA000599-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ25430, MGC20204, SDR19C1
dehydrogenase/reductase (SDR family) member 1
Anti-DHRS1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 115817
UniProt: Q96LJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKW
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DHRS1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & centrosome.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line U-138MG (DSMZ)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
HPA000599-100ul
HPA000599-100ul
HPA000599-100ul