Anti-IGBP1

Catalog Number: ATA-HPA000634
Article Name: Anti-IGBP1
Biozol Catalog Number: ATA-HPA000634
Supplier Catalog Number: HPA000634
Alternative Catalog Number: ATA-HPA000634-100,ATA-HPA000634-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IBP1
immunoglobulin binding protein 1
Anti-IGBP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3476
UniProt: P78318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IGBP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line A-431
HPA000634-100ul
HPA000634-100ul
HPA000634-100ul