Anti-ACIN1
Catalog Number:
ATA-HPA000657
- Images (6)
| Article Name: | Anti-ACIN1 |
| Biozol Catalog Number: | ATA-HPA000657 |
| Supplier Catalog Number: | HPA000657 |
| Alternative Catalog Number: | ATA-HPA000657-100,ATA-HPA000657-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ACINUS, fSAP152, KIAA0670 |
| apoptotic chromatin condensation inducer 1 |
| Anti-ACIN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 22985 |
| UniProt: | Q9UKV3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ACIN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells and cells in granular layer. |
|
|
Western blot analysis in human cell line RT-4, human cell line EFO-21 and human cell line U-138MG. |
|
|
HPA000657-100ul |
|
|
HPA000657-100ul |
|
|
HPA000657-100ul |
Product Guarantee and Expert Support
