Anti-TECPR2

Catalog Number: ATA-HPA000658
Article Name: Anti-TECPR2
Biozol Catalog Number: ATA-HPA000658
Supplier Catalog Number: HPA000658
Alternative Catalog Number: ATA-HPA000658-100,ATA-HPA000658-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0329
tectonin beta-propeller repeat containing 2
Anti-TECPR2
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 9895
UniProt: O15040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TECPR2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry analysis in human cerebral cortex and colon tissues using Anti-TECPR2 antibody. Corresponding TECPR2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human colon shows low expression as expected.
HPA000658-100ul
HPA000658-100ul
HPA000658-100ul