Anti-SH3BP1

Catalog Number: ATA-HPA000757
Article Name: Anti-SH3BP1
Biozol Catalog Number: ATA-HPA000757
Supplier Catalog Number: HPA000757
Alternative Catalog Number: ATA-HPA000757-100,ATA-HPA000757-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ARHGAP43
SH3-domain binding protein 1
Anti-SH3BP1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 23616
UniProt: Q9Y3L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ENLSNLRYLMKFLARLAEEQEVNKMTPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGLFSAVTLQDTVSDRLASEELPSTAVPTPATTPAPAPAPAPAPAPALASAATKERTESEVPP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SH3BP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry analysis in human spleen and kidney tissues using Anti-SH3BP1 antibody. Corresponding SH3BP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA000757-100ul
HPA000757-100ul
HPA000757-100ul