Anti-ENO3

Catalog Number: ATA-HPA000793
Article Name: Anti-ENO3
Biozol Catalog Number: ATA-HPA000793
Supplier Catalog Number: HPA000793
Alternative Catalog Number: ATA-HPA000793-100,ATA-HPA000793-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ENO3
enolase 3 (beta, muscle)
Anti-ENO3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2027
UniProt: P13929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ENO3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human skeletal muscle and tonsil tissues using Anti-ENO3 antibody. Corresponding ENO3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human tonsil shows low expression as expected.
HPA000793-100ul
HPA000793-100ul
HPA000793-100ul