Anti-GRK3
Catalog Number:
ATA-HPA000804
- Images (6)
| Article Name: | Anti-GRK3 |
| Biozol Catalog Number: | ATA-HPA000804 |
| Supplier Catalog Number: | HPA000804 |
| Alternative Catalog Number: | ATA-HPA000804-100,ATA-HPA000804-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ADRBK2, BARK2 |
| G protein-coupled receptor kinase 3 |
| Anti-GRK3 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 157 |
| UniProt: | P35626 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | YEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GRK3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus. |
|
|
Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells. |
|
|
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17 Lane 2: Human cell line RT-4 |
|
|
HPA000804-100ul |
|
|
HPA000804-100ul |
|
|
HPA000804-100ul |
Product Guarantee and Expert Support
