Anti-AHSA1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-AHSA1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA000903
• Supplier Catalog Number: HPA000903
• Alternative Catalog Number: ATA-HPA000903-100,ATA-HPA000903-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C14orf3, p38

Product Description

AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast)

Additional Information

Anti-AHSA1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 10598
• UniProt: O95433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: AHSA1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human breast shows strong cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17
Lane 2: Human cell line RT-4
Lane 3: Human cell line EFO-21
Lane 4: Human cell line A-431
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

HPA000903

HPA000903

HPA000903

HPA000903

HPA000903