Anti-NKAP

Catalog Number: ATA-HPA000916
Article Name: Anti-NKAP
Biozol Catalog Number: ATA-HPA000916
Supplier Catalog Number: HPA000916
Alternative Catalog Number: ATA-HPA000916-100,ATA-HPA000916-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ22626
NFKB activating protein
Anti-NKAP
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 79576
UniProt: Q8N5F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKEREESLRQKRLS
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: NKAP
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human tonsil shows nuclear positivity in lymphoid cells.
Immunohistochemical staining of human cerebral cortex shows nuclear positivity in neurons.
Immunohistochemical staining of human small intestine shows moderate nuclear positivity in glandular cells.
HPA000916-100ul
HPA000916-100ul
HPA000916-100ul