Anti-MPP5
Catalog Number:
ATA-HPA000993
- Images (8)
| Article Name: | Anti-MPP5 |
| Biozol Catalog Number: | ATA-HPA000993 |
| Supplier Catalog Number: | HPA000993 |
| Alternative Catalog Number: | ATA-HPA000993-100,ATA-HPA000993-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12615, PALS1 |
| membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) |
| Anti-MPP5 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 64398 |
| UniProt: | Q8N3R9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTAL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MPP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon, eye, retina, kidney and lymph node using Anti-MPP5 antibody HPA000993 (A) shows similar protein distribution across tissues to independent antibody HPA063890 (B). |
|
|
Immunohistochemical staining of human eye, retina using Anti-MPP5 antibody HPA000993. |
|
|
Immunohistochemical staining of human lymph node using Anti-MPP5 antibody HPA000993. |
|
|
Immunohistochemical staining of human kidney using Anti-MPP5 antibody HPA000993. |
|
|
Immunohistochemical staining of human colon using Anti-MPP5 antibody HPA000993. |
|
|
HPA000993-100ul |
|
|
HPA000993-100ul |
|
|
HPA000993-100ul |
Product Guarantee and Expert Support
