Anti-CSTA Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001031
Article Name: Anti-CSTA Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001031
Supplier Catalog Number: HPA001031
Alternative Catalog Number: ATA-HPA001031-100,ATA-HPA001031-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: STF1, STFA
cystatin A (stefin A)
Anti-CSTA
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 1475
UniProt: P01040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CSTA
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line hTCEpi shows localization to nucleus & cytosol.
Immunohistochemical staining of human skin shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CSTA antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human esophagus tissue.
HPA001031
HPA001031
HPA001031