Anti-BRD1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001063
Article Name: Anti-BRD1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001063
Supplier Catalog Number: HPA001063
Alternative Catalog Number: ATA-HPA001063-100,ATA-HPA001063-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: BRL, BRPF2
bromodomain containing 1
Anti-BRD1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23774
UniProt: O95696
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IAAEVGQSSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BRD1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA001063
HPA001063
HPA001063