Anti-PLA2G6
Catalog Number:
ATA-HPA001171
- Images (6)
| Article Name: | Anti-PLA2G6 |
| Biozol Catalog Number: | ATA-HPA001171 |
| Supplier Catalog Number: | HPA001171 |
| Alternative Catalog Number: | ATA-HPA001171-100,ATA-HPA001171-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | iPLA2, iPLA2beta, NBIA2, PARK14, PNPLA9 |
| phospholipase A2, group VI (cytosolic, calcium-independent) |
| Anti-PLA2G6 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 8398 |
| UniProt: | O60733 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PLA2G6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to microtubule organizing center. |
|
|
Western blot analysis in human cell line HEL. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and PLA2G6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400377). |
|
|
HPA001171-100ul |
|
|
HPA001171-100ul |
|
|
HPA001171-100ul |
Product Guarantee and Expert Support
