Anti-IKBKB

Catalog Number: ATA-HPA001249
Article Name: Anti-IKBKB
Biozol Catalog Number: ATA-HPA001249
Supplier Catalog Number: HPA001249
Alternative Catalog Number: ATA-HPA001249-100,ATA-HPA001249-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IKK-beta, IKK2, IKKB, NFKBIKB
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Anti-IKBKB
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 3551
UniProt: O14920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IKBKB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-IKBKB antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in human cell line A-549.
HPA001249-100ul
HPA001249-100ul
HPA001249-100ul