Anti-FCN1
Catalog Number:
ATA-HPA001295
- Images (8)
| Article Name: | Anti-FCN1 |
| Biozol Catalog Number: | ATA-HPA001295 |
| Supplier Catalog Number: | HPA001295 |
| Alternative Catalog Number: | ATA-HPA001295-100,ATA-HPA001295-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FCNM |
| ficolin (collagen/fibrinogen domain containing) 1 |
| Anti-FCN1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2219 |
| UniProt: | O00602 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FCN1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-FCN1 antibody. Corresponding FCN1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human bone marrow shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FCN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400731). |
|
|
HPA001295-100ul |
|
|
|
|
|
HPA001295-100ul |
|
|
HPA001295-100ul |
Product Guarantee and Expert Support
