Anti-CASP8

Catalog Number: ATA-HPA001302
Article Name: Anti-CASP8
Biozol Catalog Number: ATA-HPA001302
Supplier Catalog Number: HPA001302
Alternative Catalog Number: ATA-HPA001302-100,ATA-HPA001302-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: Casp-8, FLICE, MACH, MCH5
caspase 8, apoptosis-related cysteine peptidase
Anti-CASP8
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 841
UniProt: Q14790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CASP8
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center and non-germinal center cells.
Western blot analysis in human cell line RPMI-8226.
HPA001302-100ul
HPA001302-100ul
HPA001302-100ul