Anti-TRIB2

Catalog Number: ATA-HPA001305
Article Name: Anti-TRIB2
Biozol Catalog Number: ATA-HPA001305
Supplier Catalog Number: HPA001305
Alternative Catalog Number: ATA-HPA001305-100,ATA-HPA001305-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GS3955, TRB2
tribbles pseudokinase 2
Anti-TRIB2
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 28951
UniProt: Q92519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLRE
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRIB2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp.
Western blot analysis in human cell line K562.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001305-100ul
HPA001305
HPA001305
HPA001305