Anti-CCDC50
Catalog Number:
ATA-HPA001336
- Images (7)
| Article Name: | Anti-CCDC50 |
| Biozol Catalog Number: | ATA-HPA001336 |
| Supplier Catalog Number: | HPA001336 |
| Alternative Catalog Number: | ATA-HPA001336-100,ATA-HPA001336-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C3orf6, DFNA44, Ymer |
| coiled-coil domain containing 50 |
| Anti-CCDC50 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 152137 |
| UniProt: | Q8IVM0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAYADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLMAEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CCDC50 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells outside reaction center. |
|
|
Western blot analysis in human cell lines U-251MG and A-549 using Anti-CCDC50 antibody. Corresponding CCDC50 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA001336-100ul |
|
|
HPA001336-100ul |
|
|
HPA001336-100ul |
Product Guarantee and Expert Support
