Anti-FLOT2 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA001396
Article Name: Anti-FLOT2 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA001396
Supplier Catalog Number: HPA001396
Alternative Catalog Number: ATA-HPA001396-100,ATA-HPA001396-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ECS-1, ECS1, ESA, ESA1, M17S1
flotillin 2
Anti-FLOT2
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 2319
UniProt: Q14254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: FLOT2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-FLOT2 antibody. Corresponding FLOT2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line RT-4.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA001396
HPA001396
HPA001396