Anti-CHUK
Catalog Number:
ATA-HPA001402
- Images (6)
| Article Name: | Anti-CHUK |
| Biozol Catalog Number: | ATA-HPA001402 |
| Supplier Catalog Number: | HPA001402 |
| Alternative Catalog Number: | ATA-HPA001402-100,ATA-HPA001402-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IkBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16 |
| conserved helix-loop-helix ubiquitous kinase |
| Anti-CHUK |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 1147 |
| UniProt: | O15111 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHUK |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts. |
|
|
HPA001402-100ul |
|
|
|
|
|
HPA001402-100ul |
|
|
HPA001402-100ul |
Product Guarantee and Expert Support
